PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09773
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 285aa    MW: 31353.7 Da    PI: 5.7866
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09773genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
         EMT09773 19 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding48.12.7e-1572116147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
         EMT09773  72 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 116
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-231469IPR009057Homeodomain-like
PROSITE profilePS5129416.8431466IPR017930Myb domain
SuperFamilySSF466891.05E-2817113IPR009057Homeodomain-like
SMARTSM007172.2E-121868IPR001005SANT/Myb domain
PfamPF002491.9E-141966IPR001005SANT/Myb domain
CDDcd001671.24E-112266No hitNo description
PROSITE profilePS5129424.51767121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2570121IPR009057Homeodomain-like
SMARTSM007172.2E-1471119IPR001005SANT/Myb domain
PfamPF002491.2E-1372116IPR001005SANT/Myb domain
CDDcd001672.81E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRHAGTGGG GGVQQKLRKG LWSPEEDEKL YNHIIRYGVG CWSSVPKLAG LQRCGKSCRL  60
RWINYLRPDL KRGSFSQQEE DAIVGLHEIL GNRWSQIASH LPGRTDNEIK NFWNSCLKKK  120
LRQRGIDPST HKPISGVAGL EPDQASKDER PQAADGLALK QQQQQQQVFD PFPVADTFGA  180
GFDGAGMPLY DHLGGKDAAG FVDYSSVLDV SENLGYGESS SNSSNWNSAP EASNALEGEA  240
LHWASESKVE PFAGYAGDED DKFALPCHGQ QEHSMAHFDF NLEYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28171215108B-MYB
1h8a_C6e-281712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116122LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3725340.0AK372534.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3004I06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569634.11e-167PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-105MYB3_HORVU; Myb-related protein Hv33
TrEMBLM8C3T50.0M8C3T5_AEGTA; Myb-related protein Hv33
STRINGBRADI2G47590.11e-167(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-74myb domain protein 86